PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10034464
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 642aa    MW: 72887.7 Da    PI: 5.4443
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10034464genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF72.14.9e-231053245
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                 + e +snrqvt+skRr+gilKKA+ELS+LCd+++++++fs+tg+
  Lus10034464 10 KLEHTSNRQVTYSKRRHGILKKAKELSILCDIDILLLMFSPTGR 53
                 56899*************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006625.343161IPR002100Transcription factor, MADS-box
SMARTSM004323.9E-30160IPR002100Transcription factor, MADS-box
CDDcd002665.63E-28283No hitNo description
SuperFamilySSF554552.35E-26294IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-18323IPR002100Transcription factor, MADS-box
PfamPF003196.0E-201155IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-182338IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-183859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 642 aa     Download sequence    Send to blast
MGRVKLKIKK LEHTSNRQVT YSKRRHGILK KAKELSILCD IDILLLMFSP TGRPTLFNGE  60
RGIEDVIAKF AQLTPQERAK RKMESLETLK KTFKKLDHDV NIQAFFGARG QTIEEVTDQV  120
RAMQAQVTEL DRRLSYWMDP EKIDSIEQIQ QMEASIRESL SRISLHKENI KNHQLMSLDC  180
SSQFQNGMQL PLMMNGLHDT NSLSWLANNG RQNLVLTNEP NALHHSSMMV NYKDYYRDME  240
CSMESSAAGY HGFFSLEKQP DIENPGLMDN MGQQAGHFSE LGSSSRLSLQ LGEQFPYHGY  300
GSLCLAADEK KFELQMGNNL NENHNVYEVN NNNDVEISRP MYEDGHNNWI PAVDGPSGVA  360
IFDQNPPYPQ VQQPQCGSST FVFCFDIEDV IAKFAQLTPQ ERAKRYSPHH QITELSNSYK  420
QEVTDQVRAM QAQENIKNHQ LMSLDCSSQF QNGMQLPLMM NGLHDTNSLS WLANNGRQNL  480
VLTNEPNALH HSSMMVNYKD YYRDMECSME SSAAGYHGFF SLEKQPDIEN PGLMDNMGQQ  540
AGHFSELGSS SRLSLQLGEQ FPYHGYGSLC LAADEKKFEL QMGNNLNENH NVYEVNNNND  600
VEISRPMYED GHNNWIPAVD GPSGVAIFDQ NPPYPQVNNV L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S1e-13191190Myocyte-specific enhancer factor 2B
1tqe_R1e-13191190Myocyte-specific enhancer factor 2B
1tqe_Q1e-13191190Myocyte-specific enhancer factor 2B
1tqe_P1e-13191190Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015572064.11e-143PREDICTED: agamous-like MADS-box protein AGL65 isoform X1
TrEMBLD7SIA11e-142D7SIA1_VITVI; Putative uncharacterized protein
STRINGVIT_17s0000g06340.t011e-141(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27503370
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.19e-77AGAMOUS-like 65